HPA011268

ART3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011268
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011268, RRID:AB_1845059
Product name
Anti-ART3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011268
Antibody type
Polyclonal
Antigen
Ecto-ADP-ribosyltransferase 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHFYLTRALQLLRKPCEASSKTVVYRTSQGTSFTF
GGLNQARFGHFTLAYSAKPQAANDQLTVLSIYTCL
GVDIENFLDKESERITLIPLNEVFQVSQEGAGNNL
ILQSINKTCSHYECAFLGGLKTENCIENLEYFQPI
YVYNPGEK
Storage
-20C
Provider Type Product Number
- No reagents -