HPA011916

SYNJ1 antibody from Sigma-Aldrich
INPP5G, PARK20
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011916
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011916, RRID:AB_1857692
Product name
Anti-SYNJ1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011916
Antibody type
Polyclonal
Antigen
Synaptojanin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGK
ELLNRTITIALKSPDWIKNLEEEMSLEKISIALPS
STSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLP
QHLQPSSSSGLGTSPSSSPRTSPCQS
Storage
-20C
Provider Type Product Number
- No reagents -