HPA016938

ATP6V0D1 antibody from Sigma-Aldrich
ATP6D, ATP6DV, P39, VATX, Vma6, VPATPD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016938
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016938, RRID:AB_1845191
Product name
Anti-ATP6V0D1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016938
Antibody type
Polyclonal
Antigen
Vacuolar proton pump subunit d1(V-ATPase subunit d 1) (V-ATPase AC39 subunit) (V-ATPase 40 kDa accessory protein) (P39) (32 kDa accessory protein).
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQV
KNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEV
KLNKLAFLNQFHFGVFYAFVKL
Storage
-20C
Provider Type Product Number
- No reagents -