HPA011917

IGSF8 antibody from Sigma-Aldrich
CD316, CD81P3, EWI2, PGRL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011917
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011917, RRID:AB_1851536
Product name
Anti-IGSF8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011917
Antibody type
Polyclonal
Antigen
Immunoglobulin superfamily member 8 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PDVLQVSAAPPGPRGRQAPTSPPRMTVHEGQELAL
GCLARTSTQKHTHLAVSFGRSVPEAPVGRSTLQEV
VGIRSDLAVEAGAPYAERLAAGELRLGKEGTDRYR
MVVGGAQAGDAGTYHCTAAEWIQDPDGSWAQIAEK
RAVLAHVDVQ
Storage
-20C
Provider Type Product Number
- No reagents -