HPA001165

UTY antibody from Sigma-Aldrich
KDM6AL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001165
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001165, RRID:AB_1080541
Product name
Anti-UTY antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001165
Antibody type
Polyclonal
Antigen
Ubiquitously transcribed Y chromosome tetratricopeptide repeat protein (Ubiquitously transcribed TPR protein on the Y chromosome).
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SNSCILLDKCPPPRPPTSPYPPLPKDKLNPPTPSI
YLENKRDAFFPPLHQFCTNPKNPVTVIRGLAGALK
LDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWD
PTGTKKIWRCESNRSHTTI
Storage
-20C
Provider Type Product Number
- No reagents -