Antibody data

Product number
H00004974-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004974-M06, RRID:AB_1111997
Product name
OMG monoclonal antibody (M06), clone 1A8
Provider product page
Abnova Corporation - H00004974-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant OMG.
Antigen sequence
CPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHL
NLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPA
HLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDV
SKNM
Isotype
IgG
Antibody clone number
1A8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -