Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004974-M06 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004974-M06, RRID:AB_1111997
- Product name
- OMG monoclonal antibody (M06), clone 1A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant OMG.
- Antigen sequence
CPLQCICTERHRHVDCSGRNLSTLPSGLQENIIHL
NLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPA
HLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDV
SKNM- Isotype
- IgG
- Antibody clone number
- 1A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Oligodendrocyte myelin glycoprotein does not influence node of ranvier structure or assembly.
Chang KJ, Susuki K, Dours-Zimmermann MT, Zimmermann DR, Rasband MN
The Journal of neuroscience : the official journal of the Society for Neuroscience 2010 Oct 27;30(43):14476-81
The Journal of neuroscience : the official journal of the Society for Neuroscience 2010 Oct 27;30(43):14476-81
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged OMG is approximately 10ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol