HPA012693

OMG antibody from Sigma-Aldrich
OMGP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012693
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012693, RRID:AB_1854239
Product name
Anti-OMG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012693
Antibody type
Polyclonal
Antigen
Oligodendrocyte-myelin glycoprotein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTL
DISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSD
TAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNL
SSNK
Storage
-20C
Provider Type Product Number
- No reagents -