HPA007865

BCAN antibody from Sigma-Aldrich
BEHAB, CSPG7, MGC13038
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007865
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007865, RRID:AB_1078299
Product name
Anti-BCAN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007865
Antibody type
Polyclonal
Antigen
Brevican core protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNG
ELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYA
AWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLP
GVKTLFLFPNQTGFPNKHSRFNVYCFR
Storage
-20C
Provider Type Product Number
- No reagents -