Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009086-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009086-M01, RRID:AB_1137184
- Product name
- EIF1AY monoclonal antibody (M01), clone 1B4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EIF1AY.
- Antigen sequence
EKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVK
RLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADV
ILKY- Isotype
- IgG
- Antibody clone number
- 1B4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of EIF1AY expression in transfected 293T cell line by EIF1AY monoclonal antibody (M01), clone 1B4.Lane 1: EIF1AY transfected lysate(16.4 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EIF1AY monoclonal antibody (M01), clone 1B4. Western Blot analysis of EIF1AY expression in HeLa.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to EIF1AY on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol