HPA011389

NAPG antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011389
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011389, RRID:AB_1854306
Product name
Anti-NAPG antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011389
Antibody type
Polyclonal
Antigen
Gamma-soluble NSF attachment protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFK
NAKQFEQAKDACLREAVAHENNRALFHAAKAYEQA
GMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAM
ALERAGKLIENVDPEKAVQLYQQTANVFENEERLR
QAVELLG
Storage
-20C
Provider Type Product Number
- No reagents -