ABIN633469

antibody from antibodies-online

Targeting: DAZ2 MGC126442, pDP1678

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN633469 - Provider product page
Provider: antibodies-online
Product name: anti-Deleted in Azoospermia 2 (DAZ2) (N-Term) antibody
Antibody type: Polyclonal
Antigen: DAZ2 antibody was raised using the N terminal of DAZ2 corresponding to a region with amino acids MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQ
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: N-Term
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

DAZ2 protein structure - ABIN633469 shown in red.