HPA001566

CYB5R3 antibody from Sigma-Aldrich
DIA1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001566
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001566, RRID:AB_1078601
Product name
Anti-CYB5R3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001566
Antibody type
Polyclonal
Antigen
NADH-cytochrome b5 reductase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAG
GTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKD
ILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQ
GFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACL
PNLDH
Storage
-20C
Provider Type Product Number
- No reagents -