Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183357 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Annexin A1 (ANXA1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ANXA1 antibody: synthetic peptide directed towards the N terminal of human ANXA1
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSS
DVAAL HKAIMVKGVD- Vial size
- 0.1 mg
Submitted references Comparative proteomics reveals a systemic vulnerability in the vasculature of patients with abdominal aortic aneurysms.
An annexin 1 N-terminal peptide activates leukocytes by triggering different members of the formyl peptide receptor family.
Nordon IM, Hinchliffe RJ, Malkawi AH, Pirianov G, Torsney E, Loftus IM, Cockerill GW, Thompson MM
Journal of vascular surgery 2011 Oct;54(4):1100-1108.e6
Journal of vascular surgery 2011 Oct;54(4):1100-1108.e6
An annexin 1 N-terminal peptide activates leukocytes by triggering different members of the formyl peptide receptor family.
Ernst S, Lange C, Wilbers A, Goebeler V, Gerke V, Rescher U
Journal of immunology (Baltimore, Md. : 1950) 2004 Jun 15;172(12):7669-76
Journal of immunology (Baltimore, Md. : 1950) 2004 Jun 15;172(12):7669-76
No comments: Submit comment
No validations: Submit validation data