HPA011272

ANXA1 antibody from Atlas Antibodies
ANX1, LPC1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011272
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011272, RRID:AB_1844884
Product name
Anti-ANXA1
Provider product page
Atlas Antibodies - HPA011272
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSA
VSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILT
KRNNAQRQQIKAAYLQETGKPLDETLKKALTG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -