HPA011272

antibody from Atlas Antibodies

Targeting: ANXA1 ANX1, LPC1

Antibody data

Submit

Validation data

Product number: HPA011272 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA011272, RRID:AB_1844884
Product name: Anti-ANXA1
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSA VSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILT KRNNAQRQQIKAAYLQETGKPLDETLKKALTG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ANXA1 protein structure - HPA011272 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Genetic validation
Main image
Experimental details: Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ANXA1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Western blot analysis using Anti-ANXA1 antibody HPA011272 (A) shows similar pattern to independent antibody HPA011271 (B).
Antibody #2 product nr: HPA011271
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human esophagus and cerebral cortex tissues using HPA011272 antibody. Corresponding ANXA1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, esophagus, lung and lymph node using Anti-ANXA1 antibody HPA011272 (A) shows similar protein distribution across tissues to independent antibody HPA011271 (B).
Antibody #2 product nr: HPA011271
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human esophagus shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lung shows strong positivity in macrophages.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows moderate positivity in non-germinal center cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows strong positivity in lymphoid cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human esophagus shows strong positivity in squamous epithelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-ANXA1 antibody HPA011272.
Sample type: HUMAN