HPA011272

ANXA1 antibody from Sigma-Aldrich
ANX1, LPC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011272
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011272, RRID:AB_1844884
Product name
Anti-ANXA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011272
Antibody type
Polyclonal
Antigen
Annexin A1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSA
VSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILT
KRNNAQRQQIKAAYLQETGKPLDETLKKALTG
Storage
-20C
Provider Type Product Number
- No reagents -