HPA023483

STXBP1 antibody from Atlas Antibodies
hUNC18, MUNC18-1, rbSec1, UNC18
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023483
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023483, RRID:AB_1857625
Product name
Anti-STXBP1
Provider product page
Atlas Antibodies - HPA023483
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPI
VTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDI
MEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYG
HWHKNKAPGEYRSGP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -