Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006812-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006812-M01, RRID:AB_565989
- Product name
- STXBP1 monoclonal antibody (M01), clone 6D1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant STXBP1.
- Antigen sequence
VYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTD
SCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQ
VYSLDSADSFQSFYSPHKAQMKNPI- Isotype
- IgG
- Antibody clone number
- 6D1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- STXBP1 monoclonal antibody (M01), clone 6D1. Western Blot analysis of STXBP1 expression in Raw 264.7 ( Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of STXBP1 expression in transfected 293T cell line by STXBP1 monoclonal antibody (M01), clone 6D1.Lane 1: STXBP1 transfected lysate (Predicted MW: 68.7 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged STXBP1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to STXBP1 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol