HPA008209

STXBP1 antibody from Sigma-Aldrich
hUNC18, MUNC18-1, rbSec1, UNC18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008209
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008209, RRID:AB_1857624
Product name
Anti-STXBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008209
Antibody type
Polyclonal
Antigen
Syntaxin-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYE
SQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQI
ATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDA
YKADDPT
Storage
-20C
Provider Type Product Number
- No reagents -