Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007541-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007541-M02, RRID:AB_1112224
- Product name
- ZFP161 monoclonal antibody (M02), clone 4F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZFP161.
- Antigen sequence
TKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRA
PDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHE
RRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSER
KQVTP- Isotype
- IgG
- Antibody clone number
- 4F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ZFP161 expression in transfected 293T cell line by ZFP161 monoclonal antibody (M02), clone 4F7.Lane 1: ZFP161 transfected lysate (Predicted MW: 51 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ZFP161 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol