HPA008241

CGREF1 antibody from Sigma-Aldrich
CGR11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008241
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008241, RRID:AB_1846605
Product name
Anti-CGREF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008241
Antibody type
Polyclonal
Antigen
Cell growth regulator with EF hand domain protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYL
KGLGRTEVQLEHLSREQVLLYLFALHDYDQSGQLD
GLELLSMLTAALAPGAANSPTTNPVILIVDKVLET
QDLNGDGLMTPAELINFPGVALRHVEPG
Storage
-20C
Provider Type Product Number
- No reagents -