Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030413 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA030413, RRID:AB_10601455
- Product name
- Anti-ARHGAP28
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VLPVHSNGSPEPGQPVQNAISDDDFLEKNIPPEAE
ELSFEVSYSEMVTEALKRNKLKKSEIKKEDYVLTK
FNVQKTRFGL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Contribution of Antibody-based Protein Profiling to the Human Chromosome-centric Proteome Project (C-HPP)
Fagerberg L, Oksvold P, Skogs M, Älgenäs C, Lundberg E, Pontén F, Sivertsson Å, Odeberg J, Klevebring D, Kampf C, Asplund A, Sjöstedt E, Al-Khalili Szigyarto C, Edqvist P, Olsson I, Rydberg U, Hudson P, Ottosson Takanen J, Berling H, Björling L, Tegel H, Rockberg J, Nilsson P, Navani S, Jirström K, Mulder J, Schwenk J, Zwahlen M, Hober S, Forsberg M, von Feilitzen K, Uhlén M
Journal of Proteome Research 2013 June;12(6):2439-2448
Journal of Proteome Research 2013 June;12(6):2439-2448
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line CACO-2 shows localization to nucleoplasm & cell junctions.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and endometrium tissues using Anti-ARHGAP28 antibody. Corresponding ARHGAP28 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows low expression as expected.
- Sample type
- HUMAN