HPA030413

ARHGAP28 antibody from Atlas Antibodies
FLJ10312, KIAA1314

Antibody data

Product number
HPA030413
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA030413, RRID:AB_10601455
Product name
Anti-ARHGAP28
Provider product page
Atlas Antibodies - HPA030413
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLPVHSNGSPEPGQPVQNAISDDDFLEKNIPPEAE
ELSFEVSYSEMVTEALKRNKLKKSEIKKEDYVLTK
FNVQKTRFGL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.