H00079822-B01

ARHGAP28 antibody from Abnova Corporation
FLJ10312, KIAA1314

Antibody data

Product number
H00079822-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079822-B01, RRID:AB_1203969
Product name
ARHGAP28 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00079822-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ARHGAP28 protein.
Antigen sequence
MNELPRDTCGNHTNQLDGTKEERELPRVIKTSGSM
PDDASLNSTTLSDASQDKEGSFAVPRSDSVAILET
IPVLPVHSNGSPEPGQPVQNAISDDDFLEKNIPPE
AEELSFEVSYSEMVTEALKRNKLKKSEIKKEDYVL
TKFNVQKTRFGLTEAGDLSAEDMKKIRHLSLIELT
AFFDAFGIQLKRNKTEKVKGRDNGIFGVPLTVLLD
GDRKKDPGVKVPLVLQKFFEKVEESGLESEGIFRL
SGCTAKVKQYREELDAKFNADKFKWDKMCHREAAV
MLKAFFRELPTSLFPVEYIPAFISLMERGPHVKVQ
FQALHLMVMALPDANRDAAQALMTFFNKVIANESK
NRMSLWNISTVMAPNLFFSRSKHSDYEELLLANTA
AHIIRLMLKYQKILWKVPSFLITQVRRMNEATMLL
KKQLPSVRKLLRRKTLERETASPKTSKVLQKSPSA
RRMSDVPEGVIRVHAPLLSKVSMAIQLNNQTKAKD
ILAKFQYENRILHWQRAALSFLNGKWVKKEREEST
ETNRSPKHVFLFTIGLDIST
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -