AV53789

ARHGAP28 antibody from MilliporeSigma / Merck KGaA
FLJ10312, KIAA1314
No application information provided.

Antibody data

Product number
AV53789
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ARHGAP28 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV53789
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ARHGAP28 with an internal ID of P30631
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TKAKDILAKFQYENRILHWQRAALSFLNGKWVKKE
REESTETNRSPKHVF
Storage
-20C