Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010928-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010928-M02, RRID:AB_489784
- Product name
- RALBP1 monoclonal antibody (M02), clone 2A1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant RALBP1.
- Antigen sequence
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISP
TKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGK
KKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKR
SKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEK
HKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQE
PEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLP
AVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKA
AYDREESTNLEDYEPNTVASLLKQYLRDLPENLLT
KELMPRFEEACGRTTETEKVQEFQRLLKELPECNY
LLISWLIVHMDHVIAKELETKMNIQNISIVLSPTV
QISNRVLYVFFTHVQELFGNVVLKQVMKPLRWSNM
ATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKI
AQEIASLSKEDVSKEEMNENEEVINILLAQENEIL
TEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQ
SRQQHGRSETEEYSSESESESEDEEELQIILEDLQ
RQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQ
MQRAKAEQQAQEDEEPEWRGGAVQPPRDGVLEPKA
AREQPKAGKEPAKPSPSRDRKETSI- Isotype
- IgG
- Antibody clone number
- 2A1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Dual effects of Ral-activated pathways on p27 localization and TGF-β signaling.
Dynamics of the subcellular localization of RalBP1/RLIP through the cell cycle: the role of targeting signals and of protein-protein interactions.
The RalB small GTPase mediates formation of invadopodia through a GTPase-activating protein-independent function of the RalBP1/RLIP76 effector.
Ras-related small GTPases RalA and RalB regulate cellular survival after ionizing radiation.
Mass spectroscopic phosphoprotein mapping of Ral binding protein 1 (RalBP1/Rip1/RLIP76).
Expression of ral GTPases, their effectors, and activators in human bladder cancer.
Tazat K, Harsat M, Goldshmid-Shagal A, Ehrlich M, Henis YI
Molecular biology of the cell 2013 Jun;24(11):1812-24
Molecular biology of the cell 2013 Jun;24(11):1812-24
Dynamics of the subcellular localization of RalBP1/RLIP through the cell cycle: the role of targeting signals and of protein-protein interactions.
Fillatre J, Delacour D, Van Hove L, Bagarre T, Houssin N, Soulika M, Veitia RA, Moreau J
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2012 May;26(5):2164-74
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2012 May;26(5):2164-74
The RalB small GTPase mediates formation of invadopodia through a GTPase-activating protein-independent function of the RalBP1/RLIP76 effector.
Neel NF, Rossman KL, Martin TD, Hayes TK, Yeh JJ, Der CJ
Molecular and cellular biology 2012 Apr;32(8):1374-86
Molecular and cellular biology 2012 Apr;32(8):1374-86
Ras-related small GTPases RalA and RalB regulate cellular survival after ionizing radiation.
Kidd AR 3rd, Snider JL, Martin TD, Graboski SF, Der CJ, Cox AD
International journal of radiation oncology, biology, physics 2010 Sep 1;78(1):205-12
International journal of radiation oncology, biology, physics 2010 Sep 1;78(1):205-12
Mass spectroscopic phosphoprotein mapping of Ral binding protein 1 (RalBP1/Rip1/RLIP76).
Herlevsen MC, Theodorescu D
Biochemical and biophysical research communications 2007 Oct 12;362(1):56-62
Biochemical and biophysical research communications 2007 Oct 12;362(1):56-62
Expression of ral GTPases, their effectors, and activators in human bladder cancer.
Smith SC, Oxford G, Baras AS, Owens C, Havaleshko D, Brautigan DL, Safo MK, Theodorescu D
Clinical cancer research : an official journal of the American Association for Cancer Research 2007 Jul 1;13(13):3803-13
Clinical cancer research : an official journal of the American Association for Cancer Research 2007 Jul 1;13(13):3803-13
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RALBP1 monoclonal antibody (M02), clone 2A1 Western Blot analysis of RALBP1 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RALBP1 monoclonal antibody (M02), clone 2A1. Western Blot analysis of RALBP1 expression in C32 ( Cat # L002V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RALBP1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of RALBP1 transfected lysate using anti-RALBP1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with RALBP1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol