Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005530-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005530-M03, RRID:AB_606827
- Product name
- PPP3CA monoclonal antibody (M03), clone 2G8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PPP3CA.
- Antigen sequence
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVF
DNDGKPRVDILKAHLMKEGRLEESVALRIITEGAS
ILRQEKNLLDIDAP- Isotype
- IgG
- Antibody clone number
- 2G8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references No impact of protein phosphatases on connexin 43 phosphorylation in ischemic preconditioning.
Totzeck A, Boengler K, van de Sand A, Konietzka I, Gres P, Garcia-Dorado D, Heusch G, Schulz R
American journal of physiology. Heart and circulatory physiology 2008 Nov;295(5):H2106-12
American journal of physiology. Heart and circulatory physiology 2008 Nov;295(5):H2106-12
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PPP3CA expression in transfected 293T cell line by PPP3CA monoclonal antibody (M03), clone 2G8.Lane 1: PPP3CA transfected lysate (Predicted MW: 57.7 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PPP3CA monoclonal antibody (M03), clone 2G8. Western Blot analysis of PPP3CA expression in rat brain.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to PPP3CA on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to PPP3CA on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol