Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503232 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Protein Phosphatase 3, Catalytic Subunit, alpha Isozyme (PPP3CA) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the middle region of human PPP3CA
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine, Rabbit, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHK
ITSFE EAKGLDRINE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The secondary structure of calcineurin regulatory region and conformational change induced by calcium/calmodulin binding.
Shen X, Li H, Ou Y, Tao W, Dong A, Kong J, Ji C, Yu S
The Journal of biological chemistry 2008 Apr 25;283(17):11407-13
The Journal of biological chemistry 2008 Apr 25;283(17):11407-13
No comments: Submit comment
No validations: Submit validation data