HPA012778

PPP3CA antibody from Sigma-Aldrich
CALN, CALNA, CNA1, PPP2B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012778
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012778, RRID:AB_1855660
Product name
Anti-PPP3CA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012778
Antibody type
Polyclonal
Antigen
Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFD
NDGKPRVDILKAHLMKEGRLEESVALRIITEGASI
LRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVG
Storage
-20C
Provider Type Product Number
- No reagents -