HPA012778

PPP3CA antibody from Atlas Antibodies
CALN, CALNA, CNA1, PPP2B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012778
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012778, RRID:AB_1235347
Product name
Anti-PPP3CA
Provider product page
Atlas Antibodies - HPA012778
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFD
NDGKPRVDILKAHLMKEGRLEESVALRIITEGASI
LRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -