WH0011031M1

RAB31 antibody from Sigma-Aldrich
Rab22B
ELISA
Recommended by provider

Antibody data

Product number
WH0011031M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0011031M1, RRID:AB_1843224
Product name
Monoclonal Anti-RAB31 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0011031M1
Antibody type
Monoclonal
Antigen
RAB31 (AAH01148, a.a. 96-195) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
TLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVP
LKDAKEYAESIGAIVVETSAKNAINIEELFQGISR
QIPPLDPHENGNNGTIKVEKPTMQASRRCC (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -