Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011031-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011031-M03, RRID:AB_622373
- Product name
- RAB31 monoclonal antibody (M03), clone 4D12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAB31.
- Antigen sequence
TLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVP
LKDAKEYAESIGAIVVETSAKNAINIEELFQGISR
QIPPLDPHENGNNGTIKVEKPTMQASRRCC- Isotype
- IgG
- Antibody clone number
- 4D12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references p75 neurotrophin receptor regulates glucose homeostasis and insulin sensitivity.
Baeza-Raja B, Li P, Le Moan N, Sachs BD, Schachtrup C, Davalos D, Vagena E, Bridges D, Kim C, Saltiel AR, Olefsky JM, Akassoglou K
Proceedings of the National Academy of Sciences of the United States of America 2012 Apr 10;109(15):5838-43
Proceedings of the National Academy of Sciences of the United States of America 2012 Apr 10;109(15):5838-43
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RAB31 monoclonal antibody (M03), clone 4D12. Western Blot analysis of RAB31 expression in Hela S3 NE(Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to RAB31 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol