Antibody data

Product number
H00011031-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011031-M03, RRID:AB_622373
Product name
RAB31 monoclonal antibody (M03), clone 4D12
Provider product page
Abnova Corporation - H00011031-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RAB31.
Antigen sequence
TLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVP
LKDAKEYAESIGAIVVETSAKNAINIEELFQGISR
QIPPLDPHENGNNGTIKVEKPTMQASRRCC
Isotype
IgG
Antibody clone number
4D12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -