Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023114-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023114-A01, RRID:AB_535278
- Product name
- NFASC polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant NFASC.
- Antigen sequence
KDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCV
ASTELDQDLAKAYLTVLADQATPTNRLAALPKGRP
DRPRDLELTDLAERSVRLTWIPGDANNS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NFASC polyclonal antibody (A01), Lot # 060614JCS1 Western Blot analysis of NFASC expression in HepG2 ( Cat # L019V1 ).