HPA008832

NFASC antibody from Atlas Antibodies
FLJ46866, KIAA0756, NF, NRCAML
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008832
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008832, RRID:AB_1234950
Product name
Anti-NFASC
Provider product page
Atlas Antibodies - HPA008832
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDD
SLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVL
ADQATPTNRLAALPKGRPDRPRDLELTDLAERSVR
LTWIPGDANNSPITDYVVQFE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -