HPA008832

NFASC antibody from Sigma-Aldrich
FLJ46866, KIAA0756, NF, NRCAML
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008832
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008832, RRID:AB_1854411
Product name
Anti-NFASC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008832
Antibody type
Polyclonal
Antigen
Neurofascin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDD
SLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVL
ADQATPTNRLAALPKGRPDRPRDLELTDLAERSVR
LTWIPGDANNSPITDYVVQFE
Storage
-20C
Provider Type Product Number
- No reagents -