Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405522 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-F-Box Protein 25 (FBXO25) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FBXO25 antibody: synthetic peptide directed towards the N terminal of human FBXO25
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQL
TSLSG VAQKNYFNIL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Characterization of FBX25, encoding a novel brain-expressed F-box protein.
Hagens O, Minina E, Schweiger S, Ropers HH, Kalscheuer V
Biochimica et biophysica acta 2006 Jan;1760(1):110-8
Biochimica et biophysica acta 2006 Jan;1760(1):110-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-FBXO25 Antibody Titration: 0.2-1 μg/mL ELISA Titer: 1:.12500 Positive Control: Human Brain