HPA027480

AC090691.3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027480
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027480, RRID:AB_10601351
Product name
Anti-AC090691.2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027480
Antibody type
Polyclonal
Antigen
cDNA FLJ46459 fis, clone THYMU3020970 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SENPSHYRKEFLHITQSFNLTWHDIYIILISTLTP
DEKGAPGVQLKPTQMNSIIKPLYKIQWPMMHFPTE
THTRFTIRETMAPVWTDGAGA
Storage
-20C
Provider Type Product Number
- No reagents -