HPA008932

ENDOD1 antibody from Sigma-Aldrich
KIAA0830
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008932
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008932, RRID:AB_2262252
Product name
Anti-ENDOD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008932
Antibody type
Polyclonal
Antigen
Endonuclease domain-containing 1 protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGEDLYILTGTVPSDYRVKDKVAVPEFVWLAACCA
VPGGGWAMGFVKHTRDSDIIEDVMVKDLQKLLPFN
PQLFQNNCGETEQDTEKMKKILEVVNQIQDEERMV
QSQKSSSPLSSTRSKRSTLLPPEASEGSSSFLGKL
MGFIATPF
Storage
-20C
Provider Type Product Number
- No reagents -