HPA010517

ENDOD1 antibody from MilliporeSigma / Merck KGaA
KIAA0830
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010517
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA010517, RRID:AB_1852351
Product name
Anti-ENDOD1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA010517
Antibody type
Polyclonal
Antigen
Endonuclease domain-containing 1 protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GECDKFFYAGTPPAGLAADSHVKICQRAEGAERFA
TLYSTRDRIPVYSAFRAPRPAPGGAEQRWLVEPQI
DDPNSNLEEAINEAEAITSVNSLGSKQALNTDYLD
SDYQRGQLYPFSLSSDVQVATFTLTNSAPMTQSF
Storage
-20C
Provider Type Product Number
- No reagents -