Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Immunohistochemistry [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008933 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008933, RRID:AB_1847033
- Product name
- Anti-CNDP1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQP
VPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQ
LPDGQSLPIPPVILAELGSDPTKGTVCFYGHL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Circulating carnosine dipeptidase 1 associates with weight loss and poor prognosis in gastrointestinal cancer.
Analysis of plasma from prostate cancer patients links decreased carnosine dipeptidase 1 levels to lymph node metastasis
Different conformational forms of serum carnosinase detected by a newly developed sandwich ELISA for the measurements of carnosinase concentrations
Generation of monospecific antibodies based on affinity capture of polyclonal antibodies
Toward next generation plasma profiling via heat-induced epitope retrieval and array-based assays.
Relevance of allosteric conformations and homocarnosine concentration on carnosinase activity
Arner P, Henjes F, Schwenk JM, Darmanis S, Dahlman I, Iresjö BM, Naredi P, Agustsson T, Lundholm K, Nilsson P, Rydén M
PloS one 2015;10(4):e0123566
PloS one 2015;10(4):e0123566
Analysis of plasma from prostate cancer patients links decreased carnosine dipeptidase 1 levels to lymph node metastasis
Qundos U, Johannesson H, Fredolini C, O’Hurley G, Branca R, Uhlén M, Wiklund F, Bjartell A, Nilsson P, Schwenk J
Translational Proteomics 2014 March;2
Translational Proteomics 2014 March;2
Different conformational forms of serum carnosinase detected by a newly developed sandwich ELISA for the measurements of carnosinase concentrations
Adelmann K, Frey D, Riedl E, Koeppel H, Pfister F, Peters V, Schmitt C, Sternik P, Hofmann S, Zentgraf H, Navis G, van den Born J, Bakker S, Krämer B, Yard B, Hauske S
Amino Acids 2012 July;43(1):143-151
Amino Acids 2012 July;43(1):143-151
Generation of monospecific antibodies based on affinity capture of polyclonal antibodies
Hjelm B, Forsström B, Igel U, Johannesson H, Stadler C, Lundberg E, Ponten F, Sjöberg A, Rockberg J, Schwenk J, Nilsson P, Johansson C, Uhlén M
Protein Science 2011 November;20(11):1824-1835
Protein Science 2011 November;20(11):1824-1835
Toward next generation plasma profiling via heat-induced epitope retrieval and array-based assays.
Schwenk JM, Igel U, Neiman M, Langen H, Becker C, Bjartell A, Ponten F, Wiklund F, Grönberg H, Nilsson P, Uhlen M
Molecular & cellular proteomics : MCP 2010 Nov;9(11):2497-507
Molecular & cellular proteomics : MCP 2010 Nov;9(11):2497-507
Relevance of allosteric conformations and homocarnosine concentration on carnosinase activity
Peters V, Kebbewar M, Jansen E, Jakobs C, Riedl E, Koeppel H, Frey D, Adelmann K, Klingbeil K, Mack M, Hoffmann G, Janssen B, Zschocke J, Yard B
Amino Acids 2010 May;38(5):1607-1615
Amino Acids 2010 May;38(5):1607-1615
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and colon tissues using Anti-CNDP1 antibody. Corresponding CNDP1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows low expression as expected.
- Sample type
- HUMAN