Antibody data
- Product number
- HPA016934
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA016934, RRID:AB_2732417
- Product name
- Anti-C16orf89
- Provider product page
- Atlas Antibodies - HPA016934
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TQGPLQQSQDYINLFCANMMDLNRRAEAIGYAYPT
RDIFMENIMFCGMGGFSDFYKLRWLEAILSWQKQQ
EGCFGEPDAEDEESSKAIQYQQHF
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis using Anti-C16orf89 antibody HPA016934.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human colon using Anti-C16orf89 antibody HPA016934.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human thyroid gland using Anti-C16orf89 antibody HPA016934.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human kidney using Anti-C16orf89 antibody HPA016934.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Immunohistochemical staining of human colon, kidney, testis and thyroid gland using Anti-C16orf89 antibody HPA016934 (A) shows similar protein distribution across tissues to independent antibody HPA013613 (B).
- Antibody #2 product nr
- HPA013613
- Antibody provider
- Atlas Antibodies
- Show more