HPA013613

antibody from Atlas Antibodies

Targeting: C16orf89 MGC45438

Antibody data

Submit

Validation data

Product number: HPA013613 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA013613, RRID:AB_1845584
Product name: Anti-C16orf89
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: KSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSL HYLKLSDPKYLREFQLTLQPGFWKLPHAWIHTDAS LVYPTFGPQDSFSEERSDVCLVQLLGTGTDSSEPC GLSDLCRSLMTKPGCSGYCLSHQLLFFLWA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

C16orf89 protein structure - HPA013613 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, testis and thyroid gland using Anti-C16orf89 antibody HPA013613 (A) shows similar protein distribution across tissues to independent antibody HPA016934 (B).
Antibody #2 product nr: HPA016934
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human thyroid gland using Anti-C16orf89 antibody HPA013613.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-C16orf89 antibody HPA013613.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-C16orf89 antibody HPA013613.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-C16orf89 antibody HPA013613.
Sample type: HUMAN