Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000939 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000939, RRID:AB_1079402
- Product name
- Anti-MOAP1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RRRLLESLRGPALDVIRVLKINNPLITVDECLQAL
EEVFGVTDNPRELQVKYLTTYQKDEEKLSAYVLRL
EPLLQKLVQRGAIERDAVNQARLDQVIAGAVHKTI
RRELNLPEDGPAPGFLQLLVLIKDYEAAE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references MOAP‐1‐mediated dissociation of p62/SQSTM1 bodies releases Keap1 and suppresses Nrf2 signaling
The BAX-binding protein MOAP1 associates with LC3 and promotes closure of the phagophore
Downregulation of the proapoptotic protein MOAP-1 by the UBR5 ubiquitin ligase and its role in ovarian cancer resistance to cisplatin
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Modulator of Apoptosis 1: A Highly Regulated RASSF1A-Interacting BH3-Like Protein
Tan C, Chang H, Zhou Q, Yu C, Fu N, Sabapathy K, Yu V
EMBO reports 2021;22(1)
EMBO reports 2021;22(1)
The BAX-binding protein MOAP1 associates with LC3 and promotes closure of the phagophore
Chang H, Tao R, Tan C, Wu Y, Bay B, Yu V
Autophagy 2021;17(11):3725-3739
Autophagy 2021;17(11):3725-3739
Downregulation of the proapoptotic protein MOAP-1 by the UBR5 ubiquitin ligase and its role in ovarian cancer resistance to cisplatin
Matsuura K, Huang N, Cocce K, Zhang L, Kornbluth S
Oncogene 2016;36(12):1698-1706
Oncogene 2016;36(12):1698-1706
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013;10(4):315-323
Nature Methods 2013;10(4):315-323
Modulator of Apoptosis 1: A Highly Regulated RASSF1A-Interacting BH3-Like Protein
Law J, Yu V, Baksh S
Molecular Biology International 2012;2012
Molecular Biology International 2012;2012
No comments: Submit comment
No validations: Submit validation data