Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA000939 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA000939, RRID:AB_1079402
- Product name
- Anti-MOAP1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RRRLLESLRGPALDVIRVLKINNPLITVDECLQAL
EEVFGVTDNPRELQVKYLTTYQKDEEKLSAYVLRL
EPLLQKLVQRGAIERDAVNQARLDQVIAGAVHKTI
RRELNLPEDGPAPGFLQLLVLIKDYEAAE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Modulator of Apoptosis 1: A Highly Regulated RASSF1A-Interacting BH3-Like Protein.
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
Modulator of Apoptosis 1: A Highly Regulated RASSF1A-Interacting BH3-Like Protein.
Law J, Yu VC, Baksh S
Molecular biology international 2012;2012:536802
Molecular biology international 2012;2012:536802
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & cell junctions.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.
- Sample type
- HUMAN