HPA000939

MOAP1 antibody from Sigma-Aldrich
MAP-1, PNMA4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000939
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000939, RRID:AB_1079402
Product name
Anti-MOAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000939
Antibody type
Polyclonal
Antigen
Modulator of apoptosis 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRRLLESLRGPALDVIRVLKINNPLITVDECLQAL
EEVFGVTDNPRELQVKYLTTYQKDEEKLSAYVLRL
EPLLQKLVQRGAIERDAVNQARLDQVIAGAVHKTI
RRELNLPEDGPAPGFLQLLVLIKDYEAAE
Storage
-20C
Provider Type Product Number
- No reagents -