HPA008142

TBC1D10A antibody from Sigma-Aldrich
AC004997.C22.2, EPI64, TBC1D10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008142
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008142, RRID:AB_1080209
Product name
Anti-TBC1D10A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008142
Antibody type
Polyclonal
Antigen
TBC1 domain family member 10A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NWDKWMAKKHKKIRLRCQKGIPPSLRGRAWQYLSG
GKVKLQQNPGKFDELDMSPGDPKWLDVIERDLHRQ
FPFHEMFVSRGGHGQQDLFRVLKAYTLYRPEEGYC
QAQAPIAAVLLMHMPAEQAFWCLVQICEKYLPGYY
SEKLEAIQLDG
Storage
-20C
Provider Type Product Number
- No reagents -