HPA008213

antibody from Atlas Antibodies

Targeting: CACNA2D1 CACNA2, CACNL2A, LINC01112, lncRNA-N3, MHS3

Antibody data

Submit

Validation data

Product number: HPA008213 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA008213, RRID:AB_1233654
Product name: Anti-CACNA2D1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: QPKNPKSQEPVTLDFLDAELENDIKVEIRNKMIDG ESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTD YSLALVLPTYSFYYIKAKLEETITQARSKKGKMKD SETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEF L
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CACNA2D1 protein structure - HPA008213 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human duodenum and pancreas tissues using HPA008213 antibody. Corresponding CACNA2D1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, liver and skeletal muscle using Anti-CACNA2D1 antibody HPA008213 (A) shows similar protein distribution across tissues to independent antibody HPA008621 (B).
Antibody #2 product nr: HPA008621
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows moderate positivity.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows moderate positivity.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate to strong membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows moderate to strong membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-CACNA2D1 antibody HPA008213.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-CACNA2D1 antibody HPA008213.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle using Anti-CACNA2D1 antibody HPA008213.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-CACNA2D1 antibody HPA008213.
Sample type: HUMAN