HPA008213

CACNA2D1 antibody from Sigma-Aldrich
CACNA2, CACNL2A, LINC01112, lncRNA-N3, MHS3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008213
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008213, RRID:AB_1845862
Product name
Anti-CACNA2D1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008213
Antibody type
Polyclonal
Antigen
Voltage-dependent calcium channel subunit alpha-2/delta-1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QPKNPKSQEPVTLDFLDAELENDIKVEIRNKMIDG
ESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTD
YSLALVLPTYSFYYIKAKLEETITQARSKKGKMKD
SETLKPDNFEESGYTFIAPRDYCNDLKISDNNTEF
L
Storage
-20C
Provider Type Product Number
- No reagents -