Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001668-M01 - Provider product page
- Provider
- Abnova Corporation
- Product name
- DEFA3 monoclonal antibody (M01), clone 1A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant DEFA3.
- Antigen sequence
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQ
IAADIPEVVVSLAWDESLAPKHPGSRKNMDCYCRI
PACIAGERRYGTCIYQGRLWAFCC- Isotype
- IgG
- Antibody clone number
- 1A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of DEFA3 expression in transfected 293T cell line by DEFA3 monoclonal antibody (M01), clone 1A9.Lane 1: DEFA3 transfected lysate (Predicted MW: 10.2 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged DEFA3 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol