ABIN404766

GATA6 antibody from antibodies-online
Western blot
Data presented on provider website
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
ABIN404766
Provider
antibodies-online
Product name
anti-GATA Binding Protein 6 (GATA6) (Middle Region) antibody
Provider product page
antibodies-online - ABIN404766
Antibody type
Polyclonal
Antigen
The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the middle region of human GATA6
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Chicken/Avian, Porcine
Host
Rabbit
Antigen sequence
SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVS
LASPA EVTSSVRPDS
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -