HPA011273

HSPA12A antibody from Sigma-Aldrich
FLJ13874, KIAA0417
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011273
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011273, RRID:AB_1851190
Product name
Anti-HSPA12A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011273
Antibody type
Polyclonal
Antigen
Heat shock 70 kDa protein 12A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLLVKDGTRWCTDVFDKFISADQSVALGELVKRSY
TPAKPSQLVIVINIYSSEHDNVSFITDPGVKKCGT
LRLDLTGTSGTAVPARREIQTLMQFGDTEIKATAI
DIATSKSVKVGID
Storage
-20C
Provider Type Product Number
- No reagents -