Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006447-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006447-M02, RRID:AB_566181
- Product name
- SCG5 monoclonal antibody (M02), clone 8G11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SCG5.
- Antigen sequence
EYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPN
IVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTDDG
CLENTPDTAEFSREFQLHQHLFDPEHDYPGL- Isotype
- IgG
- Antibody clone number
- 8G11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references α-Melanocyte-stimulating hormone inhibits tumor necrosis factor α-stimulated MUC5AC expression in human nasal epithelial cells.
Lee SN, Ryu JH, Joo JH, Choi YH, Lee HJ, Kim YJ, Kim KB, Yoon JH
American journal of respiratory cell and molecular biology 2011 May;44(5):716-24
American journal of respiratory cell and molecular biology 2011 May;44(5):716-24
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SCG5 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol