HPA013136

SCG5 antibody from Sigma-Aldrich
7B2, SGNE1, SgV
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013136
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013136, RRID:AB_1856657
Product name
Anti-SCG5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013136
Antibody type
Polyclonal
Antigen
Neuroendocrine protein 7B2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYP
DPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQH
LFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVN
PYLQGQRLDNVVAKKSV
Storage
-20C
Provider Type Product Number
- No reagents -